wheyinformation

wheyinformation

We offer a unique combination of minerals important for proper bone growth including calcium, phosphorus, magnesium and zinc. Which is all part of a whey protein powder. Look here

This In-Home service is only available Monday-Friday, 8am to 5pm, in the continuous 48 states. Delivery will be scheduled by appointment. Please advise our delivery agent of any special delivery requirements, as there may be additional charges. All In-Home Delivery charges are non-refundable. There will be a 20% re-stocking fee based wheyinformation on the purchase price on all returned In-Home Delivery items. For In-Home Delivery on Furniture, allow 2-3 weeks.For In-Home Delivery on some Upholstery, allow 6-8 weeks.Assembly Many of our furniture items require a small amount of simple assembly, typically less than thirty minutes. Our products have been designed specially wheyinformation to make them sturdy and easy to assemble. If you need assistance with the assembly ordering online FAQ shipping / deliveryprivacy / securityCredit CardCanadashopper registrationorder historycontact us Please note: e-mail is not encrypted and is not considered a secure means of transmitting credit card numbers.

Where are your outlets located?We have a number of outlets located across the U.S. The best way to find the outlet nearest you is to search by state under Store Locations. Freight Charges Some items that are bulky or heavy increase our shipping costs to you. When required, we show these higher costs in ( ) immediately following the text information about the product. These charges are in place of the chart above - not added to it. Be sure to see the detailed information page for the item you are interested in to get complete product and shipping information. We require a daytime phone number for all freight merchandise in the event that our delivery company needs to contact you regarding the delivery arrangements.In-Home wheyinformation DeliveryDue to size and weight restrictions, our In-Home Delivery Service delivers some of our larger furniture items and upholstered items. When you are on a page giving us information, such as catalog request page or a checkout page, your e-mail address and credit card information are always kept secure and confidential.

For more information please call or visit your local store or call. You can use the store locator wheyinformation feature on the web site to locate the store nearest you.DESIGNER SALES We also offer a professional discount for designers in the trade. If you are a practicing designer with credentials, we are pleased to invite you to join our . As a member you will receive many special privileges. Designer Circle Card Privileges20% off all regular price purchases on behalf of a client Receive catalogs filled with distinctive home furnishings Receive notice of exciting new arrivals and special events Please visit your local store to pick up an application or contact us with your mailing address at eslaught@us.co.com and we will be glad to send you an application.

We offer a unique combination of minerals important for proper bone growth including calcium, phosphorus, magnesium and zinc. Which is all part of a whey protein powder.

wheyinformation

wheyinformation

wheymilkwheypeptideswheypermeatewheypowder

2003 protein-whey-powder.com. All Rights Reserved.