wheycream

wheycream

We offer a unique combination of minerals important for proper bone growth including calcium, phosphorus, magnesium and zinc. Which is all part of a whey protein powder. Check here

Where are your outlets located?We have a number of outlets located across the U.S. The best way to find the outlet nearest you is to search by state under Store Locations. Freight Charges Some items that are bulky or heavy increase our shipping costs to you. When required, we show these higher costs in ( ) immediately following the text information wheycream about the product. These charges are in place of the chart above - not added to it. Be sure to see the detailed information page for the item you are interested in to get complete product and shipping wheycream information. We require a daytime phone number for all freight merchandise in the event that our delivery company needs to contact you regarding the delivery arrangements.In-Home DeliveryDue wheycream to size and weight restrictions, our In-Home Delivery Service delivers some of our larger furniture items and upholstered items. When you are on a page giving us information, such as catalog request page or a checkout page, your e-mail address and credit card information are always kept secure and confidential.

This In-Home service is only available Monday-Friday, 8am to 5pm, in the continuous 48 states. Delivery will be scheduled by appointment. Please advise our delivery agent of any special delivery requirements, as there may be additional charges. All In-Home Delivery charges are non-refundable. There will be a 20% re-stocking fee based on the purchase price on all returned In-Home Delivery items. For In-Home Delivery on Furniture, allow 2-3 weeks.For In-Home Delivery on some Upholstery, allow 6-8 weeks.Assembly Many of our furniture items require a small amount of simple assembly, typically less than thirty minutes. Our products have been designed specially to make them sturdy and easy to assemble. If you need assistance with the assembly ordering online FAQ shipping / deliveryprivacy / securityCredit CardCanadashopper registrationorder historycontact us Please note: e-mail is not encrypted and is not considered a secure means of transmitting credit card numbers.

How to shop on-lineWhen you are ready to shop on-line, choose the category where you want to shop, ex: Furniture, Wall Décor, Accessories, Gifts, or Seasonal Specials. Then choose the product or products you want to purchase and add to your cart. (Note: You have the option to view your cart at any time during your shopping experience by going into "view cart" from the top navigational bar on any page.) Continue shopping as wheycream your navigate through the web site. Once you are finished shopping and are ready to place your order, click "place order" from the "view cart" page of the web site or if you are currently on a product page, click "check out" from the top navigational bar. You will be prompted to enter all of your personal information, including billing and shipping address and your wheycream credit card number.

We offer a unique combination of minerals important for proper bone growth including calcium, phosphorus, magnesium and zinc. Which is all part of a whey protein powder.

wheycream

wheycream

wheycreamswheyfactwheyfactswheyinformation
wheymilkwheypeptideswheypermeate

2003 protein-whey-powder.com. All Rights Reserved.